Lineage for d1mdp2_ (1mdp 2:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins) 
Protein D-maltodextrin-binding protein, MBP [53862] (2 species) Species Escherichia coli [TaxId:562] [53863] (13 PDB entries) 
Domain d1mdp2_: 1mdp 2: [35785]
Details for d1mdp2_
PDB Entry: 1mdp (more details), 2.3 Å
PDB Description: refined structures of two insertion(slash)deletion mutants probe function of the maltodextrin binding protein
SCOP Domain Sequences for d1mdp2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdp2_ c.94.1.1 (2:) D-maltodextrin-binding protein, MBP {Escherichia coli}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipdpgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdnag
akagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvtvl
ptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalksy
eeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaqtr
itk
SCOP Domain Coordinates for d1mdp2_:
Click to download the PDB-style file with coordinates for d1mdp2_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mdp2_:
- d1mdp2_ appears in SCOP 1.57
- d1mdp2_ appears in the current release, SCOPe 2.08
View in 3D
