![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Myoglobin [46469] (11 species) |
![]() | Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries) Uniprot P02185 |
![]() | Domain d6f19a1: 6f19 A:1-153 [356423] Other proteins in same PDB: d6f19a2 automated match to d2mgja_ complexed with eee, hem; mutant |
PDB Entry: 6f19 (more details), 1.9 Å
SCOPe Domain Sequences for d6f19a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f19a1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]} vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased lkkvgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp gdfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d6f19a1: