PDB entry 6f19

View 6f19 on RCSB PDB site
Description: Structure of Mb NMH H64V, V68A mutant complex with EDA incubated at room temperature for 5 min
Class: oxygen storage
Keywords: Myoglobin, Heme, N-methylhistidine, OXYGEN STORAGE
Deposited on 2017-11-21, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (63)
      • engineered mutation (67)
      • expression tag (153)
    Domains in SCOPe 2.08: d6f19a1, d6f19a2
  • Heterogens: EEE, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f19A (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkvgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqggsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f19A (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkvgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqgg