Lineage for d5zcoe_ (5zco E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727193Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2727194Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2727195Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2727196Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)
  8. 2727258Domain d5zcoe_: 5zco E: [356276]
    Other proteins in same PDB: d5zcoa_, d5zcob1, d5zcob2, d5zcoc_, d5zcod_, d5zcof_, d5zcog_, d5zcoh_, d5zcoi_, d5zcoj_, d5zcok_, d5zcol_, d5zcom_, d5zcon_, d5zcoo1, d5zcoo2, d5zcop_, d5zcoq_, d5zcos_, d5zcot_, d5zcou_, d5zcov_, d5zcow_, d5zcox_, d5zcoy_, d5zcoz_
    automated match to d1ocre_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcoe_

PDB Entry: 5zco (more details), 1.9 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 2 mm azide solution for 2 days
PDB Compounds: (E:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d5zcoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcoe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d5zcoe_:

Click to download the PDB-style file with coordinates for d5zcoe_.
(The format of our PDB-style files is described here.)

Timeline for d5zcoe_: