| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
| Family f.17.2.0: automated matches [227239] (1 protein) not a true family |
| Protein automated matches [226999] (2 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [255751] (7 PDB entries) |
| Domain d5zcoo1: 5zco O:1-90 [356315] Other proteins in same PDB: d5zcoa_, d5zcob2, d5zcoc_, d5zcod_, d5zcoe_, d5zcof_, d5zcog_, d5zcoh_, d5zcoi_, d5zcoj_, d5zcok_, d5zcol_, d5zcom_, d5zcon_, d5zcoo2, d5zcop_, d5zcoq_, d5zcor_, d5zcos_, d5zcot_, d5zcou_, d5zcov_, d5zcow_, d5zcox_, d5zcoy_, d5zcoz_ automated match to d3ag3b1 complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5zco (more details), 1.9 Å
SCOPe Domain Sequences for d5zcoo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zcoo1 f.17.2.0 (O:1-90) automated matches {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei
Timeline for d5zcoo1:
View in 3DDomains from other chains: (mouse over for more information) d5zcoa_, d5zcob1, d5zcob2, d5zcoc_, d5zcod_, d5zcoe_, d5zcof_, d5zcog_, d5zcoh_, d5zcoi_, d5zcoj_, d5zcok_, d5zcol_, d5zcom_, d5zcon_, d5zcop_, d5zcoq_, d5zcor_, d5zcos_, d5zcot_, d5zcou_, d5zcov_, d5zcow_, d5zcox_, d5zcoy_, d5zcoz_ |