SCOPe 2.08: Domain d5zcpc_: 5zcp C:

Lineage for d5zcpc_ (5zcp C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)

8. Domain d5zcpc_: 5zcp C: [356220]
   Other proteins in same PDB: d5zcpa_, d5zcpb1, d5zcpb2, d5zcpd_, d5zcpe_, d5zcpf_, d5zcpg_, d5zcph_, d5zcpi_, d5zcpj_, d5zcpk_, d5zcpl_, d5zcpm_, d5zcpn_, d5zcpo1, d5zcpo2, d5zcpq_, d5zcpr_, d5zcps_, d5zcpt_, d5zcpu_, d5zcpv_, d5zcpw_, d5zcpx_, d5zcpy_, d5zcpz_
   automated match to d2occc_
   complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcpc_

PDB Entry: 5zcp, 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 2 days

PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5zcpc_:

Sequence; same for both SEQRES and ATOM records:

>d5zcpc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d5zcpc_:

• d5zcpc_ first appeared in SCOPe 2.07