Lineage for d5zcpt_ (5zcp T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3024907Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 3024908Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 3024909Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 3024910Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries)
  8. 3024942Domain d5zcpt_: 5zcp T: [356153]
    Other proteins in same PDB: d5zcpa_, d5zcpb1, d5zcpb2, d5zcpc_, d5zcpd_, d5zcpe_, d5zcpf_, d5zcph_, d5zcpi_, d5zcpj_, d5zcpk_, d5zcpl_, d5zcpm_, d5zcpn_, d5zcpo1, d5zcpo2, d5zcpp_, d5zcpq_, d5zcpr_, d5zcps_, d5zcpu_, d5zcpv_, d5zcpw_, d5zcpx_, d5zcpy_, d5zcpz_
    automated match to d3ag3g_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcpt_

PDB Entry: 5zcp (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (T:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d5zcpt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcpt_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d5zcpt_:

Click to download the PDB-style file with coordinates for d5zcpt_.
(The format of our PDB-style files is described here.)

Timeline for d5zcpt_: