SCOPe 2.08: Domain d5zcpk_: 5zcp K:

Lineage for d5zcpk_ (5zcp K:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)
   automatically mapped to Pfam PF05392

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)

6. Protein automated matches [190272] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187064] (26 PDB entries)

8. Domain d5zcpk_: 5zcp K: [356310]
   Other proteins in same PDB: d5zcpa_, d5zcpb1, d5zcpb2, d5zcpc_, d5zcpd_, d5zcpe_, d5zcpf_, d5zcpg_, d5zcph_, d5zcpi_, d5zcpj_, d5zcpl_, d5zcpm_, d5zcpn_, d5zcpo1, d5zcpo2, d5zcpp_, d5zcpq_, d5zcpr_, d5zcps_, d5zcpt_, d5zcpu_, d5zcpv_, d5zcpw_, d5zcpy_, d5zcpz_
   automated match to d1v54k_
   complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcpk_

PDB Entry: 5zcp, 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 2 days

PDB Compounds: (K:) cytochrome c oxidase subunit 7b, mitochondrial

SCOPe Domain Sequences for d5zcpk_:

Sequence; same for both SEQRES and ATOM records:

>d5zcpk_ f.23.5.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d5zcpk_:

• d5zcpk_ first appeared in SCOPe 2.07