SCOPe 2.08: Domain d6bfgb_: 6bfg B:

Lineage for d6bfgb_ (6bfg B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein automated matches [190228] (20 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [225091] (5 PDB entries)

8. Domain d6bfgb_: 6bfg B: [355976]
   automated match to d1p4ca_
   complexed with cit, edo, fmn, gol, lmt, na, peg, po4, so4

Details for d6bfgb_

PDB Entry: 6bfg, 2.2 Å

PDB Description: crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase

PDB Compounds: (B:) (S)-Mandelate Dehydrogenase

SCOPe Domain Sequences for d6bfgb_:

Sequence; same for both SEQRES and ATOM records:

>d6bfgb_ c.1.4.1 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
qnlfnvedyrklrqkrlpkmvydyleggaedeygvkhnrdvfqqwrfkpkrlvdvsrrsl
qaevlgkrqsmplligptglngalwpkgdlalaraatkagipfvlstasnmsiedlarqc
dgdlwfqlyvihreiaqgmvlkalhtgyttlvlttdvavngyrerdlhnrfkipmsysak
vvldgclhprwsldfvrhgmpqlanfvssqtsslemqaalmsrqmdasfnwealrwlrdl
wphkllvkgllsaedadrciaegadgvilsnhggrqldcaispmevlaqsvaktgkpvli
dsgfrrgsdivkalalgaeavllgratlyglaargetgvdevltllkadidrtlaqigcp
ditslspdylqne

Timeline for d6bfgb_:

• d6bfgb_ first appeared in SCOPe 2.07