Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein automated matches [190228] (20 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [225091] (5 PDB entries) |
Domain d6bfgb_: 6bfg B: [355976] automated match to d1p4ca_ complexed with cit, edo, fmn, gol, lmt, na, peg, po4, so4 |
PDB Entry: 6bfg (more details), 2.2 Å
SCOPe Domain Sequences for d6bfgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bfgb_ c.1.4.1 (B:) automated matches {Pseudomonas putida [TaxId: 303]} qnlfnvedyrklrqkrlpkmvydyleggaedeygvkhnrdvfqqwrfkpkrlvdvsrrsl qaevlgkrqsmplligptglngalwpkgdlalaraatkagipfvlstasnmsiedlarqc dgdlwfqlyvihreiaqgmvlkalhtgyttlvlttdvavngyrerdlhnrfkipmsysak vvldgclhprwsldfvrhgmpqlanfvssqtsslemqaalmsrqmdasfnwealrwlrdl wphkllvkgllsaedadrciaegadgvilsnhggrqldcaispmevlaqsvaktgkpvli dsgfrrgsdivkalalgaeavllgratlyglaargetgvdevltllkadidrtlaqigcp ditslspdylqne
Timeline for d6bfgb_: