PDB entry 6bfg

View 6bfg on RCSB PDB site
Description: Crystal structure of monotopic membrane protein (S)-mandelate dehydrogenase
Class: oxidoreductase
Keywords: membrane protein, Flavoprotein, alpha-hydroxy acid enzyme, TIM BARREL, OXIDOREDUCTASE
Deposited on 2017-10-26, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (S)-Mandelate Dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: mdlB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bfga_
  • Chain 'B':
    Compound: (S)-Mandelate Dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: mdlB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6bfgb_
  • Heterogens: FMN, GOL, SO4, EDO, CIT, PEG, PO4, NA, LMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bfgA (A:)
    msqnlfnvedyrklrqkrlpkmvydyleggaedeygvkhnrdvfqqwrfkpkrlvdvsrr
    slqaevlgkrqsmplligptglngalwpkgdlalaraatkagipfvlstasnmsiedlar
    qcdgdlwfqlyvihreiaqgmvlkalhtgyttlvlttdvavngyrerdlhnrfkipmsys
    akvvldgclhprwsldfvrhgmpqlanfvssqtsslemqaalmsrqmdasfnwealrwlr
    dlwphkllvkgllsaedadrciaegadgvilsnhggrqldcaispmevlaqsvaktgkpv
    lidsgfrrgsdivkalalgaeavllgratlyglaargetgvdevltllkadidrtlaqig
    cpditslspdylqnegvtntapvdhligkgthahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bfgA (A:)
    qnlfnvedyrklrqkrlpkmvydyleggaedeygvkhnrdvfqqwrfkpkrlvdvsrrsl
    qaevlgkrqsmplligptglngalwpkgdlalaraatkagipfvlstasnmsiedlarqc
    dgdlwfqlyvihreiaqgmvlkalhtgyttlvlttdvavngyrerdlhnrfkipmsysak
    vvldgclhprwsldfvrhgmpqlanfvssqtsslemqaalmsrqmdasfnwealrwlrdl
    wphkllvkgllsaedadrciaegadgvilsnhggrqldcaispmevlaqsvaktgkpvli
    dsgfrrgsdivkalalgaeavllgratlyglaargetgvdevltllkadidrtlaqigcp
    ditslspdylqne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bfgB (B:)
    msqnlfnvedyrklrqkrlpkmvydyleggaedeygvkhnrdvfqqwrfkpkrlvdvsrr
    slqaevlgkrqsmplligptglngalwpkgdlalaraatkagipfvlstasnmsiedlar
    qcdgdlwfqlyvihreiaqgmvlkalhtgyttlvlttdvavngyrerdlhnrfkipmsys
    akvvldgclhprwsldfvrhgmpqlanfvssqtsslemqaalmsrqmdasfnwealrwlr
    dlwphkllvkgllsaedadrciaegadgvilsnhggrqldcaispmevlaqsvaktgkpv
    lidsgfrrgsdivkalalgaeavllgratlyglaargetgvdevltllkadidrtlaqig
    cpditslspdylqnegvtntapvdhligkgthahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bfgB (B:)
    qnlfnvedyrklrqkrlpkmvydyleggaedeygvkhnrdvfqqwrfkpkrlvdvsrrsl
    qaevlgkrqsmplligptglngalwpkgdlalaraatkagipfvlstasnmsiedlarqc
    dgdlwfqlyvihreiaqgmvlkalhtgyttlvlttdvavngyrerdlhnrfkipmsysak
    vvldgclhprwsldfvrhgmpqlanfvssqtsslemqaalmsrqmdasfnwealrwlrdl
    wphkllvkgllsaedadrciaegadgvilsnhggrqldcaispmevlaqsvaktgkpvli
    dsgfrrgsdivkalalgaeavllgratlyglaargetgvdevltllkadidrtlaqigcp
    ditslspdylqne