Lineage for d5z2mb1 (5z2m B:1-136)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612402Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2612403Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2612557Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 2612558Protein automated matches [191267] (8 species)
    not a true protein
  7. 2612623Species Mus musculus [TaxId:10090] [355880] (2 PDB entries)
  8. 2612626Domain d5z2mb1: 5z2m B:1-136 [355882]
    Other proteins in same PDB: d5z2ma_, d5z2mb2, d5z2mc_, d5z2md2
    automated match to d4drxe_
    complexed with gtp, mg

Details for d5z2mb1

PDB Entry: 5z2m (more details), 2.14 Å

PDB Description: structure of orp1l/rab7 complex
PDB Compounds: (B:) Oxysterol-binding protein-related protein 1

SCOPe Domain Sequences for d5z2mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z2mb1 d.211.1.0 (B:1-136) automated matches {Mus musculus [TaxId: 10090]}
mnteaeqqllhharngnaeevrkllaamarmevvadidckgrsksnlgwtplhlacyfgh
kqvvedllkagakvnmlndmgdtplhraaftgrkelvlllleydadstvvngsgqtakea
thdkeirnmleavert

SCOPe Domain Coordinates for d5z2mb1:

Click to download the PDB-style file with coordinates for d5z2mb1.
(The format of our PDB-style files is described here.)

Timeline for d5z2mb1: