Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (34 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186896] (15 PDB entries) |
Domain d5z2ma_: 5z2m A: [355954] Other proteins in same PDB: d5z2mb1, d5z2mb2, d5z2md1, d5z2md2 automated match to d1yhna_ complexed with gtp, mg |
PDB Entry: 5z2m (more details), 2.14 Å
SCOPe Domain Sequences for d5z2ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z2ma_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdt aglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlg nkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkq
Timeline for d5z2ma_: