Lineage for d5z2ma_ (5z2m A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476142Protein automated matches [190047] (34 species)
    not a true protein
  7. 2476796Species Mouse (Mus musculus) [TaxId:10090] [186896] (15 PDB entries)
  8. 2476813Domain d5z2ma_: 5z2m A: [355954]
    Other proteins in same PDB: d5z2mb1, d5z2mb2, d5z2md1, d5z2md2
    automated match to d1yhna_
    complexed with gtp, mg

Details for d5z2ma_

PDB Entry: 5z2m (more details), 2.14 Å

PDB Description: structure of orp1l/rab7 complex
PDB Compounds: (A:) Ras-related protein Rab-7a

SCOPe Domain Sequences for d5z2ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z2ma_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdt
aglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlg
nkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkq

SCOPe Domain Coordinates for d5z2ma_:

Click to download the PDB-style file with coordinates for d5z2ma_.
(The format of our PDB-style files is described here.)

Timeline for d5z2ma_: