SCOPe 2.07: Domain d5z2md1: 5z2m D:1-134

Lineage for d5z2md1 (5z2m D:1-134)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (8 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [355880] (2 PDB entries)

8. Domain d5z2md1: 5z2m D:1-134 [355913]
   Other proteins in same PDB: d5z2ma_, d5z2mb2, d5z2mc_, d5z2md2
   automated match to d4drxe_
   complexed with gtp, mg

Details for d5z2md1

PDB Entry: 5z2m, 2.14 Å

PDB Description: structure of orp1l/rab7 complex

PDB Compounds: (D:) Oxysterol-binding protein-related protein 1

SCOPe Domain Sequences for d5z2md1:

Sequence; same for both SEQRES and ATOM records:

>d5z2md1 d.211.1.0 (D:1-134) automated matches {Mus musculus [TaxId: 10090]}
mnteaeqqllhharngnaeevrkllaamarmevvadidckgrsksnlgwtplhlacyfgh
kqvvedllkagakvnmlndmgdtplhraaftgrkelvlllleydadstvvngsgqtakea
thdkeirnmleave

Timeline for d5z2md1:

• d5z2md1 is new in SCOPe 2.07-stable
  
• d5z2md1 appears in the current release, SCOPe 2.08