Class a: All alpha proteins [46456] (289 folds) |
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) |
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
Protein HIV-1 capsid protein [47945] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries) |
Domain d6bhti1: 6bht I:1-147 [355568] Other proteins in same PDB: d6bhta2, d6bhtb2, d6bhtc2, d6bhtd2, d6bhte2, d6bhtf2, d6bhtg2, d6bhth2, d6bhti2, d6bhtj2, d6bhtk2, d6bhtl2 automated match to d4xfxa1 complexed with ihp |
PDB Entry: 6bht (more details), 2.69 Å
SCOPe Domain Sequences for d6bhti1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bhti1 a.73.1.1 (I:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth nppipvgeiykrwiilglnkivrmysp
Timeline for d6bhti1: