| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
| Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
| Protein HIV-1 capsid protein [47945] (1 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries) |
| Domain d6bhte1: 6bht E:1-147 [355574] Other proteins in same PDB: d6bhta2, d6bhtb2, d6bhtc2, d6bhtd2, d6bhte2, d6bhtf2, d6bhtg2, d6bhth2, d6bhti2, d6bhtj2, d6bhtk2, d6bhtl2 automated match to d4xfxa1 complexed with ihp |
PDB Entry: 6bht (more details), 2.69 Å
SCOPe Domain Sequences for d6bhte1:
Sequence, based on SEQRES records: (download)
>d6bhte1 a.73.1.1 (E:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp
>d6bhte1 a.73.1.1 (E:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvmreprgsdiagttstlqeqigwmthnppipvgei
ykrwiilglnkivrmysp
Timeline for d6bhte1: