Lineage for d6d21a2 (6d21 A:133-236)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697545Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 2697546Protein automated matches [254423] (5 species)
    not a true protein
  7. 2697636Species Zebrafish (Danio rerio) [TaxId:7955] [354854] (2 PDB entries)
  8. 2697637Domain d6d21a2: 6d21 A:133-236 [354906]
    Other proteins in same PDB: d6d21a1, d6d21a3
    automated match to d2he7a2

Details for d6d21a2

PDB Entry: 6d21 (more details), 2 Å

PDB Description: crystal structure of the ferm domain of zebrafish farp2
PDB Compounds: (A:) FERM, RhoGEF and pleckstrin domain protein 2

SCOPe Domain Sequences for d6d21a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d21a2 a.11.2.0 (A:133-236) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
pdpgqlqeeftrylfslqikrdlldgrlsctentaallashlvqseigdyddladreflk
mnkllpcqehvqekimelhrrhtgqtpaesdfqvleiarklemf

SCOPe Domain Coordinates for d6d21a2:

Click to download the PDB-style file with coordinates for d6d21a2.
(The format of our PDB-style files is described here.)

Timeline for d6d21a2: