Lineage for d6d21a1 (6d21 A:49-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933602Species Zebrafish (Danio rerio) [TaxId:7955] [338846] (3 PDB entries)
  8. 2933604Domain d6d21a1: 6d21 A:49-132 [354904]
    Other proteins in same PDB: d6d21a2, d6d21a3
    automated match to d2he7a1

Details for d6d21a1

PDB Entry: 6d21 (more details), 2 Å

PDB Description: crystal structure of the ferm domain of zebrafish farp2
PDB Compounds: (A:) FERM, RhoGEF and pleckstrin domain protein 2

SCOPe Domain Sequences for d6d21a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d21a1 d.15.1.0 (A:49-132) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
kglqirvqgldeaqefyeleskadgqlllsdvfrrinliesdyfglefqnlqmnwvwldp
sklivkqvrrpmntlfrlsvkffp

SCOPe Domain Coordinates for d6d21a1:

Click to download the PDB-style file with coordinates for d6d21a1.
(The format of our PDB-style files is described here.)

Timeline for d6d21a1: