![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries) |
![]() | Domain d6daud_: 6dau D: [354252] automated match to d4mhdc_ complexed with gol; mutant |
PDB Entry: 6dau (more details), 2.26 Å
SCOPe Domain Sequences for d6daud_:
Sequence, based on SEQRES records: (download)
>d6daud_ d.108.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]} nsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvve daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
>d6daud_ d.108.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]} nsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvve daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnre
Timeline for d6daud_: