PDB entry 6dau

View 6dau on RCSB PDB site
Description: Crystal structure of E33Q and E41Q mutant forms of the spermidine/spermine N-acetyltransferase SpeG from Vibrio cholerae
Class: transferase
Keywords: SpeG, polyamine, GNAT, N-acetyltransferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2018-05-02, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spermidine n1-acetyltransferase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:686]
    Gene: C4E16_17415
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2L2MBX3
      • engineered mutation (32)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6daua_
  • Chain 'B':
    Compound: Spermidine n1-acetyltransferase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:686]
    Gene: C4E16_17415
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2L2MBX3
      • engineered mutation (32)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6daub_
  • Chain 'C':
    Compound: Spermidine n1-acetyltransferase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:686]
    Gene: C4E16_17415
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2L2MBX3 (Start-172)
      • engineered mutation (32)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6dauc_
  • Chain 'D':
    Compound: Spermidine n1-acetyltransferase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:686]
    Gene: C4E16_17415
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2L2MBX3 (Start-172)
      • engineered mutation (32)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6daud_
  • Chain 'E':
    Compound: Spermidine n1-acetyltransferase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:686]
    Gene: C4E16_17415
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2L2MBX3 (Start-172)
      • engineered mutation (32)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6daue_
  • Chain 'F':
    Compound: Spermidine n1-acetyltransferase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:686]
    Gene: C4E16_17415
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2L2MBX3
      • engineered mutation (32)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6dauf_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dauA (A:)
    mnsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvv
    edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
    lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dauA (A:)
    nsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvve
    daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
    hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dauB (B:)
    mnsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvv
    edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
    lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dauB (B:)
    sqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvved
    aqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylh
    vavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dauC (C:)
    mnsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvv
    edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
    lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dauC (C:)
    nsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvve
    daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
    hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dauD (D:)
    mnsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvv
    edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
    lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dauD (D:)
    nsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvve
    daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
    hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dauE (E:)
    mnsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvv
    edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
    lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dauE (E:)
    qltlralergdlrfihnlnnmsywfqepyesfdqleelynkhihdnaerrfvvedaqknl
    iglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylhvaven
    pkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6dauF (F:)
    mnsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvv
    edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
    lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dauF (F:)
    qltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvveda
    qknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylhv
    avenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln