| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) ![]() |
| Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
| Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries) |
| Domain d6c1sa3: 6c1s A:544-725 [353852] Other proteins in same PDB: d6c1sa1, d6c1sa2, d6c1sa4 automated match to d1e8ya1 complexed with efv, so4 |
PDB Entry: 6c1s (more details), 2.31 Å
SCOPe Domain Sequences for d6c1sa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c1sa3 a.118.1.6 (A:544-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
raempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqei
vaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllql
vqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrg
cg
Timeline for d6c1sa3: