SCOPe 2.08: Domain d5oxrb2: 5oxr B:235-355

Lineage for d5oxrb2 (5oxr B:235-355)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Surfactant protein, lectin domain [56461] (3 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (11 PDB entries)

8. Domain d5oxrb2: 5oxr B:235-355 [353735]
   Other proteins in same PDB: d5oxra1, d5oxrb1, d5oxrc1
   automated match to d1pwba1
   complexed with ca

Details for d5oxrb2

PDB Entry: 5oxr, 1.75 Å

PDB Description: crystal structure of human lung surfactant protein d trimeric fragment with bound ligand salmonella enterica minnesota r7 oligosaccharide

PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d5oxrb2:

Sequence; same for both SEQRES and ATOM records:

>d5oxrb2 d.169.1.1 (B:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d5oxrb2:

• d5oxrb2 first appeared in SCOPe 2.07