Lineage for d5oxra1 (5oxr A:205-234)

  1. Root: SCOPe 2.08
  2. Class h: Coiled coil proteins [57942] (7 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. Protein Surfactant protein [57949] (3 species)
  7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)
  8. Domain d5oxra1: 5oxr A:205-234 [353721]
    Other proteins in same PDB: d5oxra2, d5oxrb2, d5oxrc2
    automated match to d1pwba2
    complexed with ca

Details for d5oxra1

PDB Entry: 5oxr (more details), 1.7500000000000002 Å

PDB Description: crystal structure of human lung surfactant protein d trimeric fragment with bound ligand salmonella enterica minnesota r7 oligosaccharide
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d5oxra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oxra1 h.1.1.1 (A:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d5oxra1 are not available.

Timeline for d5oxra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5oxra2
View in 3D
Domains from other chains:
(mouse over for more information)
d5oxrb1, d5oxrb2, d5oxrc1, d5oxrc2