Lineage for d5oxrc1 (5oxr C:205-234)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039232Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 3039233Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 3039305Protein Surfactant protein [57949] (3 species)
  7. 3039306Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)
  8. 3039345Domain d5oxrc1: 5oxr C:205-234 [353736]
    Other proteins in same PDB: d5oxra2, d5oxrb2, d5oxrc2
    automated match to d1pwba2
    complexed with ca

Details for d5oxrc1

PDB Entry: 5oxr (more details), 1.75 Å

PDB Description: crystal structure of human lung surfactant protein d trimeric fragment with bound ligand salmonella enterica minnesota r7 oligosaccharide
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d5oxrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oxrc1 h.1.1.1 (C:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d5oxrc1:

Click to download the PDB-style file with coordinates for d5oxrc1.
(The format of our PDB-style files is described here.)

Timeline for d5oxrc1: