SCOPe 2.08: Domain d6co1e2: 6co1 E:1538-1603

Lineage for d6co1e2 (6co1 E:1538-1603)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
   Pfam PF00567

6. Protein p53-binding protein 1, 53BP1, C-terminal domain [418915] (1 species)
   protein duplication: contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [419339] (18 PDB entries)
   Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606

8. Domain d6co1e2: 6co1 E:1538-1603 [353225]
   Other proteins in same PDB: d6co1a_, d6co1b_, d6co1c_, d6co1d_, d6co1e1, d6co1f1
   automated match to d1ssfa2
   protein/DNA complex

Details for d6co1e2

PDB Entry: 6co1, 2.18 Å

PDB Description: structure of human tirr in complex with 53bp1 tudor domains

PDB Compounds: (E:) TP53-binding protein 1

SCOPe Domain Sequences for d6co1e2:

Sequence; same for both SEQRES and ATOM records:

>d6co1e2 b.34.9.1 (E:1538-1603) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqyglg

Timeline for d6co1e2:

• d6co1e2 first appeared in SCOPe 2.07