PDB entry 6co1

View 6co1 on RCSB PDB site
Description: Structure of human TIRR in complex with 53BP1 Tudor domains
Class: protein binding
Keywords: DNA damage response, DNA repair, DNA damage signaling, 53BP1, TIRR, NUDT16L1, Protein binding
Deposited on 2018-03-10, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tudor-interacting repair regulator protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT16L1, SDOS, TIRR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6co1a_
  • Chain 'B':
    Compound: Tudor-interacting repair regulator protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT16L1, SDOS, TIRR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6co1b_
  • Chain 'C':
    Compound: Tudor-interacting repair regulator protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT16L1, SDOS, TIRR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6co1c_
  • Chain 'D':
    Compound: Tudor-interacting repair regulator protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT16L1, SDOS, TIRR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6co1d_
  • Chain 'E':
    Compound: TP53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6co1e1, d6co1e2
  • Chain 'F':
    Compound: TP53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6co1f1, d6co1f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6co1A (A:)
    mvpelkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpg
    gfvdrrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlha
    veisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmp
    eeklvealaaatekqkkalekllpass
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co1A (A:)
    vpelkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpgg
    fvdrrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlhav
    eisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpe
    eklvealaaatekqkkalekl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6co1B (B:)
    mvpelkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpg
    gfvdrrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlha
    veisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmp
    eeklvealaaatekqkkalekllpass
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co1B (B:)
    vpelkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpgg
    fvdrrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlhav
    eisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpe
    eklvealaaatekqkkalek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6co1C (C:)
    mvpelkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpg
    gfvdrrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlha
    veisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmp
    eeklvealaaatekqkkalekllpass
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co1C (C:)
    vpelkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpgg
    fvdrrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlhav
    eisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpe
    eklvealaaatekqkkalekll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6co1D (D:)
    mvpelkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpg
    gfvdrrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlha
    veisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmp
    eeklvealaaatekqkkalekllpass
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co1D (D:)
    vpelkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpgg
    fvdrrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlhav
    eisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpe
    eklvealaaatekqkkalekl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6co1E (E:)
    ghmnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipl
    dtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqy
    glg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co1E (E:)
    nsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldte
    vtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqyglg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6co1F (F:)
    ghmnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipl
    dtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqy
    glg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co1F (F:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqyglg