| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
| Protein automated matches [191036] (17 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225626] (39 PDB entries) |
| Domain d6co1d_: 6co1 D: [353266] Other proteins in same PDB: d6co1e1, d6co1e2, d6co1f1, d6co1f2 automated match to d3kvha_ protein/DNA complex |
PDB Entry: 6co1 (more details), 2.18 Å
SCOPe Domain Sequences for d6co1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6co1d_ d.113.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpelkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpgg
fvdrrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlhav
eisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpe
eklvealaaatekqkkalekl
Timeline for d6co1d_: