Lineage for d6fugc1 (6fug C:16-243)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795529Protein Factor D [50563] (1 species)
  7. 2795530Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries)
  8. 2795560Domain d6fugc1: 6fug C:16-243 [353207]
    Other proteins in same PDB: d6fuga2, d6fugc2, d6fugd2, d6fuge2, d6fugf2
    automated match to d1bioa_
    complexed with e85

Details for d6fugc1

PDB Entry: 6fug (more details), 2.21 Å

PDB Description: complement factor d in complex with the inhibitor 3-((3-((3- (aminomethyl)phenyl)amino)-1h-pyrazolo[3,4-d]pyrimidin-4-yl)amino) phenol
PDB Compounds: (C:) complement factor d

SCOPe Domain Sequences for d6fugc1:

Sequence, based on SEQRES records: (download)

>d6fugc1 b.47.1.2 (C:16-243) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

Sequence, based on observed residues (ATOM records): (download)

>d6fugc1 b.47.1.2 (C:16-243) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahclegkvqvllgahslsqpe
pskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcd
vagwgivnhagrrpdslqhvllpvldratcnrraiterlmcaesnrrdsckgdsggplvc
ggvlegvvtrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d6fugc1:

Click to download the PDB-style file with coordinates for d6fugc1.
(The format of our PDB-style files is described here.)

Timeline for d6fugc1: