PDB entry 6fug

View 6fug on RCSB PDB site
Description: Complement factor D in complex with the inhibitor 3-((3-((3-(aminomethyl)phenyl)amino)-1H-pyrazolo[3,4-d]pyrimidin-4-yl)amino)phenol
Class: hydrolase
Keywords: SERINE PROTEASE, inhibitor, complex, HYDROLASE
Deposited on 2018-02-27, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00746 (0-227)
      • expression tag (228-229)
    Domains in SCOPe 2.07: d6fuga1, d6fuga2
  • Chain 'B':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fugb_
  • Chain 'C':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00746 (0-227)
      • expression tag (228-229)
    Domains in SCOPe 2.07: d6fugc1, d6fugc2
  • Chain 'D':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00746 (0-227)
      • expression tag (228-229)
    Domains in SCOPe 2.07: d6fugd1, d6fugd2
  • Chain 'E':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00746 (0-227)
      • expression tag (228-229)
    Domains in SCOPe 2.07: d6fuge1, d6fuge2
  • Chain 'F':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00746 (0-227)
      • expression tag (228-229)
    Domains in SCOPe 2.07: d6fugf1, d6fugf2
  • Heterogens: E85, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fugA (A:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fugA (A:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahclgkvqvllgahslsqpep
    skrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcdv
    agwgivnhagrrpdslqhvllpvldratcnraiterlmcaesnrrdsckgdsggplvcgg
    vlegvvtrvcgnrkkpgiytrvasyaawidsvlasa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fugB (B:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fugB (B:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahclegkvqvllgahslsqpe
    pskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcd
    vagwgivnhagrrpdslqhvllpvldratcnterlmcaesnrrdsckgdsggplvcggvl
    egvvtrvcgnrkkpiytrvasyaawidsvla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fugC (C:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fugC (C:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahclegkvqvllgahslsqpe
    pskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcd
    vagwgivnhagrrpdslqhvllpvldratcnrraiterlmcaesnrrdsckgdsggplvc
    ggvlegvvtrvcgnrkkpgiytrvasyaawidsvlasa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fugD (D:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fugD (D:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahclegkvqvllgahslsqpe
    pskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcd
    vagwgivnhagrrpdslqhvllpvldratcnterlmcaesnrrdsckgdsggplvcggvl
    egvvtrvcgnrkkpgiytrvasyaawidsvlasa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fugE (E:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fugE (E:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahclegkvqvllgahslsqpe
    pskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcd
    vagwgivnhagrrpdslqhvllpvldratcnterlmcaesnrrdsckgdsggplvcggvl
    egvvtvcgnrkkpgiytrvasyaawidsvlasa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6fugF (F:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fugF (F:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahclegkvqvllgahslsqpe
    pskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcd
    vagwgivnhagrrpdslqhvllpvldratcnterlmcaesnrrdsckgdsggplvcggvl
    egvvtvcgnrkkpgiytrvasyaawidsvlasa