Lineage for d1a5sb_ (1a5s B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907595Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 2907621Species Salmonella typhimurium [TaxId:90371] [53689] (66 PDB entries)
  8. 2907669Domain d1a5sb_: 1a5s B: [35281]
    Other proteins in same PDB: d1a5sa_
    complexed with fip, na, plp, ser

Details for d1a5sb_

PDB Entry: 1a5s (more details), 2.3 Å

PDB Description: crystal structure of wild-type tryptophan synthase complexed with 5-fluoroindole propanol phosphate and l-ser bound as amino acrylate to the beta site
PDB Compounds: (B:) tryptophan synthase (beta chain)

SCOPe Domain Sequences for d1a5sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5sb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhd

SCOPe Domain Coordinates for d1a5sb_:

Click to download the PDB-style file with coordinates for d1a5sb_.
(The format of our PDB-style files is described here.)

Timeline for d1a5sb_: