Lineage for d1a5sb_ (1a5s B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27517Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
  4. 27518Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 27519Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (4 proteins)
  6. 27539Protein Tryptophan synthase, beta-subunit [53688] (1 species)
  7. 27540Species Salmonella typhimurium [TaxId:90371] [53689] (21 PDB entries)
  8. 27553Domain d1a5sb_: 1a5s B: [35281]
    Other proteins in same PDB: d1a5sa_

Details for d1a5sb_

PDB Entry: 1a5s (more details), 2.3 Å

PDB Description: crystal structure of wild-type tryptophan synthase complexed with 5-fluoroindole propanol phosphate and l-ser bound as amino acrylate to the beta site

SCOP Domain Sequences for d1a5sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5sb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhd

SCOP Domain Coordinates for d1a5sb_:

Click to download the PDB-style file with coordinates for d1a5sb_.
(The format of our PDB-style files is described here.)

Timeline for d1a5sb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a5sa_