SCOPe 2.08: Domain d3f51c1: 3f51 C:23-107

Lineage for d3f51c1 (3f51 C:23-107)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (21 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [346176] (2 PDB entries)

8. Domain d3f51c1: 3f51 C:23-107 [352742]
   Other proteins in same PDB: d3f51b2, d3f51c2, d3f51d2, d3f51e2, d3f51f2
   automated match to d3f52a_
   complexed with act, mpd

Details for d3f51c1

PDB Entry: 3f51, 2.05 Å

PDB Description: crystal structure of the clp gene regulator clgr from corynebacterium glutamicum

PDB Compounds: (C:) clp gene regulator (ClgR)

SCOPe Domain Sequences for d3f51c1:

Sequence; same for both SEQRES and ATOM records:

>d3f51c1 a.35.1.0 (C:23-107) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
pllrealgaalrsfradkgvtlrelaeasrvspgylselergrkevssellasvchalga
svadvlieaagsmalqaaqedlarv

Timeline for d3f51c1:

• d3f51c1 first appeared in SCOPe 2.07