Class a: All alpha proteins [46456] (289 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
Protein automated matches [190907] (17 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:1718] [346176] (2 PDB entries) |
Domain d3f51c1: 3f51 C:23-107 [352742] Other proteins in same PDB: d3f51c2, d3f51d2, d3f51e2, d3f51f2 automated match to d3f52a_ complexed with act, mpd |
PDB Entry: 3f51 (more details), 2.05 Å
SCOPe Domain Sequences for d3f51c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f51c1 a.35.1.0 (C:23-107) automated matches {Corynebacterium glutamicum [TaxId: 1718]} pllrealgaalrsfradkgvtlrelaeasrvspgylselergrkevssellasvchalga svadvlieaagsmalqaaqedlarv
Timeline for d3f51c1: