Lineage for d3f51c1 (3f51 C:23-107)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322951Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2322952Protein automated matches [190907] (17 species)
    not a true protein
  7. 2322953Species Corynebacterium glutamicum [TaxId:1718] [346176] (2 PDB entries)
  8. 2322957Domain d3f51c1: 3f51 C:23-107 [352742]
    Other proteins in same PDB: d3f51c2, d3f51d2, d3f51e2, d3f51f2
    automated match to d3f52a_
    complexed with act, mpd

Details for d3f51c1

PDB Entry: 3f51 (more details), 2.05 Å

PDB Description: crystal structure of the clp gene regulator clgr from corynebacterium glutamicum
PDB Compounds: (C:) clp gene regulator (ClgR)

SCOPe Domain Sequences for d3f51c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f51c1 a.35.1.0 (C:23-107) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
pllrealgaalrsfradkgvtlrelaeasrvspgylselergrkevssellasvchalga
svadvlieaagsmalqaaqedlarv

SCOPe Domain Coordinates for d3f51c1:

Click to download the PDB-style file with coordinates for d3f51c1.
(The format of our PDB-style files is described here.)

Timeline for d3f51c1: