Lineage for d1raaa1 (1raa A:1-150)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1620378Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1620379Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 1620380Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 1620381Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)
  7. 1620389Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
    Uniprot P00479
  8. 1620540Domain d1raaa1: 1raa A:1-150 [35160]
    Other proteins in same PDB: d1raab1, d1raab2, d1raad1, d1raad2
    complexed with ctp, zn; mutant

Details for d1raaa1

PDB Entry: 1raa (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity
PDB Compounds: (A:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d1raaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raaa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d1raaa1:

Click to download the PDB-style file with coordinates for d1raaa1.
(The format of our PDB-style files is described here.)

Timeline for d1raaa1: