Lineage for d1raaa1 (1raa A:1-150)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27322Fold c.78: ATC-like [53670] (2 superfamilies)
  4. 27323Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 27324Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)
  6. 27325Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)
  7. 27333Species Escherichia coli [TaxId:562] [53674] (27 PDB entries)
  8. 27386Domain d1raaa1: 1raa A:1-150 [35160]
    Other proteins in same PDB: d1raab1, d1raab2, d1raad1, d1raad2

Details for d1raaa1

PDB Entry: 1raa (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1raaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raaa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOP Domain Coordinates for d1raaa1:

Click to download the PDB-style file with coordinates for d1raaa1.
(The format of our PDB-style files is described here.)

Timeline for d1raaa1: