Lineage for d1raab1 (1raa B:1-100)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650481Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 1650482Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 1650483Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 1650484Species Escherichia coli [TaxId:562] [54896] (60 PDB entries)
    Uniprot P00478
  8. 1650551Domain d1raab1: 1raa B:1-100 [39033]
    Other proteins in same PDB: d1raaa1, d1raaa2, d1raab2, d1raac1, d1raac2, d1raad2
    complexed with ctp, zn; mutant

Details for d1raab1

PDB Entry: 1raa (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1raab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raab1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d1raab1:

Click to download the PDB-style file with coordinates for d1raab1.
(The format of our PDB-style files is described here.)

Timeline for d1raab1: