Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries) |
Domain d6cx8b_: 6cx8 B: [351147] Other proteins in same PDB: d6cx8e2 automated match to d4mhdc_ complexed with ipa, mn, mpd, po4 |
PDB Entry: 6cx8 (more details), 2.41 Å
SCOPe Domain Sequences for d6cx8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cx8b_ d.108.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]} mnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvv edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln
Timeline for d6cx8b_: