PDB entry 6cx8

View 6cx8 on RCSB PDB site
Description: Crystal structure of spermidine/spermine N-acetyltransferase SpeG from Vibrio cholerae in complex with manganese ions.
Class: transferase
Keywords: SpeG, spermidine, GNAT, N-acetyltransferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2018-04-02, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cx8a_
  • Chain 'B':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cx8b_
  • Chain 'C':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cx8c_
  • Chain 'D':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cx8d_
  • Chain 'E':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KL03 (3-175)
      • expression tag (2)
    Domains in SCOPe 2.07: d6cx8e1, d6cx8e2
  • Chain 'F':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cx8f_
  • Heterogens: MN, IPA, PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cx8A (A:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cx8A (A:)
    mnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvv
    edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
    lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cx8B (B:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cx8B (B:)
    mnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvv
    edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
    lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cx8C (C:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cx8C (C:)
    nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
    daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
    hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cx8D (D:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cx8D (D:)
    nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
    daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
    hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6cx8E (E:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cx8E (E:)
    amnsqltlralergdlrfihnlnnmsywfeepyesfdeleelynkhihdnaerrfvveda
    qknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylhv
    avenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6cx8F (F:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cx8F (F:)
    nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
    daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
    hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln