Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries) |
Domain d6fmjd_: 6fmj D: [350917] Other proteins in same PDB: d6fmjb1, d6fmjb2, d6fmjc_, d6fmje1, d6fmje2, d6fmjf_, d6fmjh1, d6fmjh2, d6fmji_, d6fmjk1, d6fmjk2, d6fmjl_ automated match to d1lqba_ complexed with dv5 |
PDB Entry: 6fmj (more details), 2.45 Å
SCOPe Domain Sequences for d6fmjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fmjd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d6fmjd_: