Lineage for d6fmjk1 (6fmj K:17-112)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552339Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2552434Protein Elongin C [54699] (3 species)
  7. 2552437Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries)
  8. 2552554Domain d6fmjk1: 6fmj K:17-112 [351033]
    Other proteins in same PDB: d6fmja_, d6fmjb2, d6fmjc_, d6fmjd_, d6fmje2, d6fmjf_, d6fmjg_, d6fmjh2, d6fmji_, d6fmjj_, d6fmjk2, d6fmjl_
    automated match to d1lm8c_
    complexed with dv5

Details for d6fmjk1

PDB Entry: 6fmj (more details), 2.45 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2- acetamidopropanethioyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl) benzyl)pyrrolidine-2-carboxamide (ligand 3)
PDB Compounds: (K:) Elongin-C

SCOPe Domain Sequences for d6fmjk1:

Sequence, based on SEQRES records: (download)

>d6fmjk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d6fmjk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d6fmjk1:

Click to download the PDB-style file with coordinates for d6fmjk1.
(The format of our PDB-style files is described here.)

Timeline for d6fmjk1: