Lineage for d6fmjf_ (6fmj F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378586Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2378587Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2378588Protein VHL [49470] (1 species)
  7. 2378589Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries)
  8. 2378688Domain d6fmjf_: 6fmj F: [350866]
    Other proteins in same PDB: d6fmja_, d6fmjb1, d6fmjb2, d6fmjd_, d6fmje1, d6fmje2, d6fmjg_, d6fmjh1, d6fmjh2, d6fmjj_, d6fmjk1, d6fmjk2
    automated match to d1lm8v_
    complexed with dv5

Details for d6fmjf_

PDB Entry: 6fmj (more details), 2.45 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2- acetamidopropanethioyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl) benzyl)pyrrolidine-2-carboxamide (ligand 3)
PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6fmjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmjf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d6fmjf_:

Click to download the PDB-style file with coordinates for d6fmjf_.
(The format of our PDB-style files is described here.)

Timeline for d6fmjf_: