Class b: All beta proteins [48724] (178 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries) |
Domain d6fmjf_: 6fmj F: [350866] Other proteins in same PDB: d6fmja_, d6fmjb1, d6fmjb2, d6fmjd_, d6fmje1, d6fmje2, d6fmjg_, d6fmjh1, d6fmjh2, d6fmjj_, d6fmjk1, d6fmjk2 automated match to d1lm8v_ complexed with dv5 |
PDB Entry: 6fmj (more details), 2.45 Å
SCOPe Domain Sequences for d6fmjf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fmjf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqe
Timeline for d6fmjf_: