Lineage for d6fmic_ (6fmi C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768917Domain d6fmic_: 6fmi C: [350905]
    Other proteins in same PDB: d6fmia_, d6fmib_, d6fmid_, d6fmie_
    automated match to d1lm8v_
    complexed with dv2

Details for d6fmic_

PDB Entry: 6fmi (more details), 2.8 Å

PDB Description: pvhl:elob:eloc in complex with n-((s)-1-((2s,4r)-4-hydroxy-2-((4-(4- methylthiazol-5-yl)benzyl)carbamothioyl) pyrrolidin-1-yl)-1- oxopropan-2-yl)acetamide (ligand 2)
PDB Compounds: (C:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6fmic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmic_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerlt

SCOPe Domain Coordinates for d6fmic_:

Click to download the PDB-style file with coordinates for d6fmic_.
(The format of our PDB-style files is described here.)

Timeline for d6fmic_: