SCOPe 2.08: Domain d6fmif_: 6fmi F:

Lineage for d6fmif_ (6fmi F:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.3: VHL [49468] (1 family)
   automatically mapped to Pfam PF01847

5. Family b.3.3.1: VHL [49469] (2 proteins)

6. Protein VHL [49470] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)

8. Domain d6fmif_: 6fmi F: [350914]
   Other proteins in same PDB: d6fmia_, d6fmib_, d6fmid_, d6fmie_
   automated match to d1lm8v_
   complexed with dv2

Details for d6fmif_

PDB Entry: 6fmi, 2.8 Å

PDB Description: pvhl:elob:eloc in complex with n-((s)-1-((2s,4r)-4-hydroxy-2-((4-(4- methylthiazol-5-yl)benzyl)carbamothioyl) pyrrolidin-1-yl)-1- oxopropan-2-yl)acetamide (ligand 2)

PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6fmif_:

Sequence; same for both SEQRES and ATOM records:

>d6fmif_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerlt

Timeline for d6fmif_:

• d6fmif_ first appeared in SCOPe 2.07