Lineage for d6fmib_ (6fmi B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. Protein Elongin C [54699] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries)
  8. Domain d6fmib_: 6fmi B: [350878]
    Other proteins in same PDB: d6fmia_, d6fmic_, d6fmid_, d6fmif_
    automated match to d1lm8c_
    complexed with dv2

Details for d6fmib_

PDB Entry: 6fmi (more details), 2.8 Å

PDB Description: pvhl:elob:eloc in complex with n-((s)-1-((2s,4r)-4-hydroxy-2-((4-(4- methylthiazol-5-yl)benzyl)carbamothioyl) pyrrolidin-1-yl)-1- oxopropan-2-yl)acetamide (ligand 2)
PDB Compounds: (B:) Elongin-C

SCOPe Domain Sequences for d6fmib_:

Sequence, based on SEQRES records: (download)

>d6fmib_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d6fmib_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d6fmib_ are not available.

Timeline for d6fmib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6fmia_, d6fmic_, d6fmid_, d6fmie_, d6fmif_