Lineage for d6fmid_ (6fmi D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein Elongin B [54246] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries)
  8. Domain d6fmid_: 6fmi D: [350877]
    Other proteins in same PDB: d6fmib_, d6fmic_, d6fmie_, d6fmif_
    automated match to d1lqba_
    complexed with dv2

Details for d6fmid_

PDB Entry: 6fmi (more details), 2.8 Å

PDB Description: pvhl:elob:eloc in complex with n-((s)-1-((2s,4r)-4-hydroxy-2-((4-(4- methylthiazol-5-yl)benzyl)carbamothioyl) pyrrolidin-1-yl)-1- oxopropan-2-yl)acetamide (ligand 2)
PDB Compounds: (D:) Elongin-B

SCOPe Domain Sequences for d6fmid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmid_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d6fmid_ are not available.

Timeline for d6fmid_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6fmia_, d6fmib_, d6fmic_, d6fmie_, d6fmif_