Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
Domain d6fv0f1: 6fv0 F:6-113 [350796] Other proteins in same PDB: d6fv0f2, d6fv0f3 automated match to d5m2jd_ complexed with peg |
PDB Entry: 6fv0 (more details), 2.29 Å
SCOPe Domain Sequences for d6fv0f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fv0f1 b.1.1.1 (F:6-113) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvqpggslrlscaasgfafssywmywvrqapekglewvstintgggityykdsvk grftvsrdnakntlylqmnslkpedaaqyycatdmsgtyrgqgtqvtv
Timeline for d6fv0f1: