Lineage for d5m2jd_ (5m2j D:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) 
Domain d5m2jd_: 5m2j D: [338573]
Other proteins in same PDB: d5m2ja_
automated match to d5c3ld_
Details for d5m2jd_
PDB Entry: 5m2j (more details), 1.9 Å
PDB Description: complex between human tnf alpha and llama vhh2
PDB Compounds: (D:) Anti-(ED-B) scFVSCOPe Domain Sequences for d5m2jd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m2jd_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvesggglvqpggslrlscaasgftfsnywmywvrqapgkglewvseintnglitky
pdsvkgrftisrdnakntlylqmnslkpedtalyycarspsgfnrgqgtqvtvss
SCOPe Domain Coordinates for d5m2jd_:
Click to download the PDB-style file with coordinates for d5m2jd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5m2jd_:
- d5m2jd_ first appeared in SCOPe 2.06
- d5m2jd_ appears in SCOPe 2.07
View in 3D
