PDB entry 6fv0

View 6fv0 on RCSB PDB site
Description: Crystal structure of the TPR domain of KLC1 in complex with the C-terminal peptide of torsinA
Class: motor protein
Keywords: Protein complex, MOTOR PROTEIN, nanobody, cargo recognition
Deposited on 2018-02-28, released 2018-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin light chain 1,Torsin-1A
    Species: Mus musculus [TaxId:10090]
    Gene: Tor1a, Dyt1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FV0
    Domains in SCOPe 2.08: d6fv0f1, d6fv0f2, d6fv0f3
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >6fv0F (F:)
qvqlqesggglvqpggslrlscaasgfafssywmywvrqapekglewvstintgggityy
kdsvkgrftvsrdnakntlylqmnslkpedaaqyycatdmsgtyrgqgtqvtvsshhhhh
h

    Sequence, based on observed residues (ATOM records): (download) 
    >6fv0F (F:)
vqlqesggglvqpggslrlscaasgfafssywmywvrqapekglewvstintgggityyk
dsvkgrftvsrdnakntlylqmnslkpedaaqyycatdmsgtyrgqgtqvtvss