Lineage for d9icd__ (9icd -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily) Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) 
Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins) 
Protein Isocitrate dehydrogenase, ICDH [53668] (1 species) Species Escherichia coli [TaxId:562] [53669] (23 PDB entries) 
Domain d9icd__: 9icd - [35075]
Details for d9icd__
PDB Entry: 9icd (more details), 2.5 Å
PDB Description: catalytic mechanism of nadp+-dependent isocitrate dehydrogenase: implications from the structures of magnesium-isocitrate and nadp+ complexes
SCOP Domain Sequences for d9icd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d9icd__ c.77.1.1 (-) Isocitrate dehydrogenase, ICDH {Escherichia coli}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
SCOP Domain Coordinates for d9icd__:
Click to download the PDB-style file with coordinates for d9icd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d9icd__:
- d9icd__ appears in SCOP 1.57
- d9icd__ appears in the current release, SCOPe 2.08, called d9icda_
View in 3D