Lineage for d2ayqb_ (2ayq B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily) Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) 
Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins) Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (6 species) 
Species Bacillus coagulans [TaxId:1398] [53664] (1 PDB entry) 
Domain d2ayqb_: 2ayq B: [35058]
Details for d2ayqb_
PDB Entry: 2ayq (more details), 3 Å
PDB Description: 3-isopropylmalate dehydrogenase from the moderate facultative thermophile, bacillus coagulans
SCOP Domain Sequences for d2ayqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ayqb_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans}
mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnn
SCOP Domain Coordinates for d2ayqb_:
Click to download the PDB-style file with coordinates for d2ayqb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ayqb_:
- d2ayqb_ appears in SCOP 1.57
- d2ayqb_ appears in the current release, SCOPe 2.08
View in 3D
