Lineage for d1osic_ (1osi C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27255Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily)
  4. 27256Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) (S)
  5. 27257Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins)
  6. 27258Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (6 species)
  7. 27271Species Thermus thermophilus [TaxId:274] [53662] (14 PDB entries)
  8. 27288Domain d1osic_: 1osi C: [35049]

Details for d1osic_

PDB Entry: 1osi (more details), 3 Å

PDB Description: structure of 3-isopropylmalate dehydrogenase

SCOP Domain Sequences for d1osic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osic_ c.77.1.1 (C:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvlrhla

SCOP Domain Coordinates for d1osic_:

Click to download the PDB-style file with coordinates for d1osic_.
(The format of our PDB-style files is described here.)

Timeline for d1osic_: